STEAP3 (Metalloreductase STEAP3, Dudulin-2, Six-transmembrane Epithelial Antigen of Prostate 3, Tumor Suppressor-activated Pathway Protein 6, hTSAP6, pHyde, hpHyde, TSAP6) (MaxLight 650)

Size

£1,000.00

SKU:: 138393-ML650
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: N-terminus of STEAP3 corresponding to LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHY
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Extra Details:: MaxLight™ 650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice