SLCO6A1 (Solute Carrier Organic Anion Transporter Family Member 6A1, Cancer/Testis Antigen 48, CT48, Gonad-specific Transporter, GST, Organic Anion-transporting Polypeptide 6A1, Organic Anion-transporting Polypeptide I, OATP-I, Solute Carrier Family 21 Member 19, OATP6A1, SLC21A19, MGC26949) (HRP)

Size

£1,000.00

SKU:: 138385-HRP
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: N-terminus of SLCO6A1 corresponding to CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: SLCO6A1 is involved in transporter activity (solute carrier). Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.