SLC6A18 (Sodium-dependent Neutral Amino Acid Transporter B(0)AT3, Sodium- and Chloride-dependent Transporter XTRP2, Solute Carrier Family 6 Member 18, System B(0) Neutral Amino Acid Transporter AT3, XTRP2, FLJ31236)

Size

£744.00

SKU:: 138382
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC
Format:: Supplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O.
Extra Details:: SLC6A8 is required for the uptake of creatine in muscles and brain. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.