138375-BIOTIN

SLC38A4 (Sodium-coupled Neutral Amino Acid Transporter 4, Amino Acid Transporter A3, Na(+)-coupled Neutral Amino Acid Transporter 4, Solute Carrier Family 38 Member 4, System A Amino Acid Transporter 3, System N Amino Acid Transporter 3, ATA3, NAT3, SNAT4) (Biotin)

Size

£1,000.00

SKU:: 138375-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Middle region of SLC38A4 corresponding to LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: SLC38A4 is found predominantly in liver and transports both cationic and neutral aa. The transport of cationic aa by SLC38A4 is Na(+) and pH independent, while the transport of neutral aa is Na(+) and pH dependent. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.