138369
SLC35C1 (GDP-fucose Transporter 1, Solute Carrier Family 35 Member C1, FUCT1, CDG2C, FLJ11320, FLJ14841)
Size
£744.00
- SKU:
- 138369
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located within the following region: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG corresponding to the N-terminal region of human SLC35C1. Species Sequence Homology: bovine, canine, guinea pig, equine, mouse, porcine, rabbit and rat
- Format:
- Supplied as a liquid in PBS, 0.09% sodium azide, 2% sucrose
- Extra Details:
- SLC35C1 is involved in GDP-fucose import from the cytoplasm into the Golgi lumen. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice