SLC22A11 (Solute Carrier Family 22 Member 11, Organic Anion Transporter 4, OAT4, MGC34282, hOAT4)

Size

£744.00

SKU:: 138352
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW from the N-terminal region of human SLC22A11. Species sequence homology: bovine, rat
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Extra Details:: SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. Applications: Suitable for use in Western Blot. Other applications have not been tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.