SLC10A5 (Sodium/bile Acid Cotransporter 5, Na(+)/bile Acid Cotransporter 5, Solute Carrier Family 10 Member 5) (Biotin)

Size

£1,000.00

SKU:: 138341-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.