138287-PE
RHAG (Ammonium Transporter Rh Type A, Erythrocyte Membrane Glycoprotein Rh50, Erythrocyte Plasma Membrane 50kD Glycoprotein, Rh50A, Rhesus Blood Group Family Type A Glycoprotein, Rh Family Type A Glycoprotein, Rh Type A Glycoprotein, Rhesus Blood Group-associated Ammonia Channel, Rhesus Blood Group-associated Glycoprotein, CD241, RH50) (PE)
Size
£1,000.00
- SKU:
- 138287-PE
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Middle region of RHAG corresponding to FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30kD, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice