PMEL (Melanocyte Protein PMEL, ME20-M, ME20M, Melanocyte Protein Pmel 17, Melanocytes Lineage-specific Antigen GP100, Melanoma-associated ME20 Antigen, P1, P100, Premelanosome Protein, Silver Locus Protein Homolog, D12S53E, PMEL17, SILV) (Biotin)

Size

£1,000.00

SKU:: 138224-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY from the N-terminal region of human SILV. Species Sequence Homology: bovine, canine, goat, guinea pig, equine, mouse,, rabbit and rat.
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity. Applications: Suitable for use in Immunoprecipitation, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice