PAGE1 (P Antigen Family Member 1, PAGE-1, AL5, G Antigen 9, GAGE-9, G Antigen Family B Member 1, Prostate-associated Gene 1 Protein, GAGE9, GAGEB1, CT16.3)

Size

£744.00

SKU:: 138200
Application:: WB
Purity:: Purified by affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN corresponding to PAGE1.
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Extra Details:: PAGE1 belongs to a family that are expressed in a variety of tumors but not in normal tissues, except for the testis. Nothing is presently known about the function of this protein. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.