NIP7 (Nuclear Import 7 Homolog (S. cerevisiae), 60S Ribosome Subunit Biogenesis Protein NIP7 Homolog, CGI-37, FLJ10296, HSPC031, HSPC180, KD93, OK/SW-cl.76, OK/SW-cl.78) (APC)

Size

£1,000.00

SKU:: 138178-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to a VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.