138138-HRP

MLSTD2 (Fatty Acyl-CoA Reductase 1, Male Sterility Domain-containing Protein 2, FAR1, UNQ2423/PRO4981, DKFZp686A0370, DKFZp686P18247, FLJ22728, FLJ33561, SDR10E1) (HRP)

Size

£1,000.00

SKU:: 138138-HRP
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: N-terminus of MLSTD2 corresponding to LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.