FNTA (Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit alpha, CAAX Farnesyltransferase Subunit alpha, FTase-alpha, Ras Proteins Prenyltransferase Subunit alpha, Type I Protein Geranyl-geranyltransferase Subunit alpha, GGTase-I-alpha, MGC99680)

Size

£744.00

SKU:: 137981
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to the C-terminal region, DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV, of human FNTA. Species Sequence Homology: bovine, canine, equine, porcine, rabbit, rat and sheep
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Extra Details:: Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.