137981-BIOTIN
FNTA (Protein Farnesyltransferase/Geranylgeranyltransferase Type-1 Subunit alpha, CAAX Farnesyltransferase Subunit alpha, FTase-alpha, Ras Proteins Prenyltransferase Subunit alpha, Type I Protein Geranyl-geranyltransferase Subunit alpha, GGTase-I-alpha, MGC99680) (Biotin)
Size
£1,000.00
- SKU:
- 137981-BIOTIN
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to the C-terminal region, DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV, of human FNTA. Species Sequence Homology: bovine, canine, equine, porcine, rabbit, rat and sheep
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice