137948-PE
FAM107A (DRR1, TU3A, Protein FAM107A, Down-regulated in Renal Cell Carcinoma 1, Protein TU3A, FLJ30158, FLJ45473) (PE)
Size
£1,000.00
- SKU:
- 137948-PE
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Middle region of FAM107A corresponding to RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.0625ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice