ELOVL7 (Elongation of Very Long Chain Fatty Acids Protein 7, 3-keto Acyl-CoA Synthase ELOVL7, ELOVL Fatty Acid Elongase 7, ELOVL FA Elongase 7, Very-long-chain 3-oxoacyl-CoA Synthase 7, FLJ23563)

Size

£744.00

SKU:: 137932
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to the region MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS from human ELOVL7 at N-terminal. Species Sequence Homology: mouse, rat, bovine, canine, guinea pig, equine and rabbit
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Extra Details:: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 3ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.