137923-ML490

DLAT (Dihydrolipoyllysine-residue Acetyltransferase Component of Pyruvate Dehydrogenase Complex, Mitochondrial, 70kD Mitochondrial Autoantigen of Primary Biliary Cirrhosis, PBC, Dihydrolipoamide Acetyltransferase Component of Pyruvate Dehydrogenase Complex, M2 Antigen Complex 70kD Subunit, Pyruvate Dehydrogenase Complex Component E2, PDC-E2, PDCE2, DLTA) (MaxLight 490)

Size

£1,000.00

SKU:: 137923-ML490
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Synthetic peptide corresponding to WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR from the N-terminal of human DLAT. Species Sequence Homology: mouse, rat, bovine, canine, guinea pig, equine, rabbit and zebrafish
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Extra Details:: MaxLight™ 490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice