137907-BIOTIN
CUL5 (Cullin 5, CUL-5, Cullin-5, VACM1, VACM-1, Vasopressin-activated Calcium-mobilizing Receptor 1) (Biotin)
Size
£1,000.00
- SKU:
- 137907-BIOTIN
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- C-terminus of CUL5 corresponding to VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice