CLIC1 (Chloride Intracellular Channel Protein 1, Chloride Channel ABP, Nuclear Chloride Ion Channel 27, NCC27, Regulatory Nuclear Chloride Ion Channel Protein, hRNCC, G6, NCC27)

Size

£744.00

SKU:: 137853
Purity:: Purified by affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: N-terminus of CLIC1 corresponding to GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIF
Format:: Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Extra Details:: Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.