ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor, Vascular Anticoagulant-alpha, VAC-alpha, Anchorin CII, PP4, ENX2, ANX5, Annexin V) (MaxLight 650)

Size

£1,000.00

SKU:: 137546-ML650
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: N-terminus of ANXA5 corresponding to SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Extra Details:: MaxLight™ 650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice