ZNRF4 (Zinc and Ring Finger 4, Zinc/RING Finger Protein 4, RING Finger Protein 204, RNF204)

Size

£685.00

SKU:: 135824
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa108-171 from human ZNRF4 (NP_859061) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 0.1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: SSSVDFADLPALFGVPLAPEGIRGYLMEVKPANACHPIEAPRLGNRSLGSIALIRRYDCTFDL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.