135650-BIOTIN

ZNF238 (Zinc Finger Protein 238, Zinc Finger and BTB Domain-containing Protein 18, ZBTB18, 58kD Repressor Protein, RP58, Transcriptional Repressor RP58, Translin-associated Zinc Finger Protein 1, TAZ1, TAZ-1, Zinc Finger Protein C2H2-171) (Biotin)

Size

£914.00

SKU:: 135650-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa182-281 from ZNF238 (NP_991331) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.