135616-BIOTIN

ZNF18 (Zinc Finger Protein 18, Heart Development-specific Gene 1 Protein, HDSG1, Zinc Finger Protein 535, ZNF535, Zinc Finger Protein KOX11, KOX11, Zinc Finger Protein with KRAB and SCAN Domains 6, ZKSCAN6) (Biotin)

Size

£914.00

SKU:: 135616-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa282-381 from human ZNF18 (NP_653281) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PRPTCIGDRQENDKENLNLENHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLSPQERISEKQLGQHLPNPHSG* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.