ZMAT4 (Zinc Finger Matrin-type Protein 4)

Size

£685.00

SKU:: 135582
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-154 from human ZMAT4 (AAH19598) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7H3-1C11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ZMAT4 (zinc finger, matrin-type 4) is a protein-coding gene. Diseases associated with ZMAT4 include refractive error, and myopia. An important paralog of this gene is KRCC1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 0.1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.