135582-PE

ZMAT4 (Zinc Finger Matrin-type Protein 4) (PE)

Size

£914.00

SKU:: 135582-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-154 from human ZMAT4 (AAH19598) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7H3-1C11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: ZMAT4 (zinc finger, matrin-type 4) is a protein-coding gene. Diseases associated with ZMAT4 include refractive error, and myopia. An important paralog of this gene is KRCC1. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: FLISA: 0.1ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.