ZMAT4 (Zinc Finger Matrin-type Protein 4)

Size

£685.00

SKU:: 135579
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human ZMAT4, aa1-153 (AAH19598.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ZMAT4 (zinc finger, matrin-type 4) is a protein-coding gene. Diseases associated with ZMAT4 include refractive error, and myopia. An important paralog of this gene is KRCC1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.