135565-FITC

ZHX2 (Zinc Fingers and Homeoboxes Protein 2, Zinc Finger and Homeodomain Protein 2, Alpha-fetoprotein Regulator 1, AFP Regulator 1, AFR1, KIAA0854, Regulator of AFP, RAF) (FITC)

Size

£914.00

SKU:: 135565-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa691-789 from ZHX2 (NP_055758) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5E2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEES* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.