135543-FITC
ZFHX3 (Zinc Finger Homeobox Protein 3, AT Motif-binding Factor, AT-binding Transcription Factor 1, Alpha-fetoprotein Enhancer-binding Protein, Zinc Finger Homeodomain Protein 3, ZFH-3, ATBF1) (FITC)
Size
£914.00
- SKU:
- 135543-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa2811-2910 from human ZFHX3 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- ATBF1 is a transcription factor that negatively regulates alpha fetoprotein and MYB, transactivates CDKN1A, and may be a tumor suppressor. Loss of ATBF1 is one mechanism that defines the absence of growth control in prostate cancer. Presence of the isoform ABTF1-A is correlated with better prognosis in breast cancer and may also serve as a marker of endocrine responsiveness. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice