135543-BIOTIN
ZFHX3 (Zinc Finger Homeobox Protein 3, AT Motif-binding Factor, AT-binding Transcription Factor 1, Alpha-fetoprotein Enhancer-binding Protein, Zinc Finger Homeodomain Protein 3, ZFH-3, ATBF1) (Biotin)
Size
£914.00
- SKU:
- 135543-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa2811-2910 from human ZFHX3 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- ATBF1 is a transcription factor that negatively regulates alpha fetoprotein and MYB, transactivates CDKN1A, and may be a tumor suppressor. Loss of ATBF1 is one mechanism that defines the absence of growth control in prostate cancer. Presence of the isoform ABTF1-A is correlated with better prognosis in breast cancer and may also serve as a marker of endocrine responsiveness. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EDFESPSMSSVNLNFDQTKLDNDDCSSVNTAITDTTTGDEGNADNDSATGIATETKSSSAPNEGLTKAAMMAMSEYEDRLSSGLVSPAPSFYSKEYDNEG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice