135533-PE

ZDHHC13 (Zinc Finger DHHC Domain-containing Protein 13, DHHC-13, Palmitoyltransferase ZDHHC13, Huntingtin-interacting Protein 14-related Protein, HIP14-related Protein, HIP14L, Huntingtin-interacting Protein HIP3RP, HIP3RP, Putative MAPK-activating Protein PM03, Putative NF-kappa-B-activating Protein 209) (PE)

Size

£914.00

SKU:: 135533-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa181-281 from human ZDHHC13 (NP_061901) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NGQTPLMLSAHKVIGPEPTGFLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAGSSLDIQNVKGETPLDMALQNKNQLIIHMLKTEAKMRANQK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.