135533-BIOTIN

ZDHHC13 (Zinc Finger DHHC Domain-containing Protein 13, DHHC-13, Palmitoyltransferase ZDHHC13, Huntingtin-interacting Protein 14-related Protein, HIP14-related Protein, HIP14L, Huntingtin-interacting Protein HIP3RP, HIP3RP, Putative MAPK-activating Protein PM03, Putative NF-kappa-B-activating Protein 209) (Biotin)

Size

£914.00

SKU:: 135533-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa181-281 from human ZDHHC13 (NP_061901) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NGQTPLMLSAHKVIGPEPTGFLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAGSSLDIQNVKGETPLDMALQNKNQLIIHMLKTEAKMRANQK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.