ZBTB7A (Zinc Finger and BTB Domain-containing Protein 7A, ZBTB7, Factor Binding IST Protein 1, FBI1, FBI-1, Factor That Binds to Inducer of Short Transcripts Protein 1, HIV-1 1st-binding Protein 1, Leukemia/lymphoma-related Factor, LRF, POZ and Krueppel Erythroid Myeloid Ontogenic Factor, POK Erythroid Myeloid Ontogenic Factor, Pokemon, TTF-I-interacting Peptide 21, TIP21, Zinc Finger Protein 857A, ZNF857A)

Size

£685.00

SKU:: 135518
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-109 from human ZBTB7A (AAH19108) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMVLVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKPSVVAERGA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.