135518-PE

ZBTB7A (Zinc Finger and BTB Domain-containing Protein 7A, ZBTB7, Factor Binding IST Protein 1, FBI1, FBI-1, Factor That Binds to Inducer of Short Transcripts Protein 1, HIV-1 1st-binding Protein 1, Leukemia/lymphoma-related Factor, LRF, POZ and Krueppel Erythroid Myeloid Ontogenic Factor, POK Erythroid Myeloid Ontogenic Factor, Pokemon, TTF-I-interacting Peptide 21, TIP21, Zinc Finger Protein 857A, ZNF857A) (PE)

Size

£914.00

SKU:: 135518-PE
Application:: FLISA
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-109 from human ZBTB7A (AAH19108) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMVLVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKPSVVAERGA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.