135518-BIOTIN

ZBTB7A (Zinc Finger and BTB Domain-containing Protein 7A, ZBTB7, Factor Binding IST Protein 1, FBI1, FBI-1, Factor That Binds to Inducer of Short Transcripts Protein 1, HIV-1 1st-binding Protein 1, Leukemia/lymphoma-related Factor, LRF, POZ and Krueppel Erythroid Myeloid Ontogenic Factor, POK Erythroid Myeloid Ontogenic Factor, Pokemon, TTF-I-interacting Peptide 21, TIP21, Zinc Finger Protein 857A, ZNF857A) (Biotin)

Size

£914.00

SKU:: 135518-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-109 from human ZBTB7A (AAH19108) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMVLVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKPSVVAERGA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.