ZBP1 (Insulin-like Growth Factor 2 mRNA-binding Protein 1, IGF2 mRNA-binding Protein 1, IMP-1, Coding Region Determinant-binding Protein, CRD-BP, IGF-II mRNA-binding Protein 1, VICKZ Family Member 1, Zip Code-binding Protein 1, ZBP-1, Zipcode-binding Protein 1, IGF2BP1, CRDBP, VICKZ1)

Size

£685.00

SKU:: 135505
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-101 from human ZBP1 (NP_110403) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ZBP1 binds to cytoplasmic DNA and plays a role in host defense against tumors and pathogens. Highly expressed in lymphatic tissues including lymph node, leukocytes, tonsil, bone marrow and spleen. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPET Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.