135505-BIOTIN

ZBP1 (Insulin-like Growth Factor 2 mRNA-binding Protein 1, IGF2 mRNA-binding Protein 1, IMP-1, Coding Region Determinant-binding Protein, CRD-BP, IGF-II mRNA-binding Protein 1, VICKZ Family Member 1, Zip Code-binding Protein 1, ZBP-1, Zipcode-binding Protein 1, IGF2BP1, CRDBP, VICKZ1) (Biotin)

Size

£914.00

SKU:: 135505-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-101 from human ZBP1 (NP_110403) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: ZBP1 binds to cytoplasmic DNA and plays a role in host defense against tumors and pathogens. Highly expressed in lymphatic tissues including lymph node, leukocytes, tonsil, bone marrow and spleen. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPET Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.