YY1 (Yin and Yang 1, YY-1, Transcriptional Repressor Protein YY1, Delta Transcription Factor, INO80 Complex Subunit S, INO80S, NF-E1)

Size

£685.00

SKU:: 135493
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa221-321 from human YY1 (NP_003394) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA, Western Blot, Immunohistochemistry and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.