YBX1 (NSEP1, YB1, Nuclease-sensitive Element-binding Protein 1, CCAAT-binding Transcription Factor I Subunit A, DNA-binding Protein B, Enhancer Factor I Subunit A, Y-box Transcription Factor, Y-box-binding Protein 1, MGC104858, MGC110976, MGC117250)

Size

£685.00

SKU:: 135476
Purity:: Purified by Protein A affinity chromatography
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa51-139 from human YBX1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4F12
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: Mediates pre-mRNA alternative splicing regulation. Binds to splice sites in pre-mRNA and regulates splice site selection. Binds and stabilizes cytoplasmic mRNA. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors (By similarity). Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as HLA class II genes. Regulates the transcription of numerous genes. Promotes separation of DNA strands that contain mismatches or are modified by cisplatin. Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro). May play a role in DNA repair. Component of the CRD-mediated complex that promotes MYC mRNA stability. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 20ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice