XAGE2 (X Antigen Family Member 2, XAGE-2, Cancer/testis Antigen 12.2, CT12.2, G Antigen Family D Member 3, GAGED3, XAGE2B, CT12.2)

Size

£685.00

SKU:: 135432
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa44-111 from XAGE2 (NP_570133) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4C4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.