Vascular Endothelial Growth Factor Receptor 2 (VEGF Receptor 2, VEGFR 2, VEGFR2, VEGFR-2, VEGFR, CD309 Antigen, Fetal Liver Kinase 1, FLK1, Kinase Insert Domain Receptor, KDR, KRD1, Ly73, Protein Tyrosine Kinase Receptor FLK1)

Size

£685.00

SKU:: 135210
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa31-130 from human KDR (NP_002244) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: VEGFR2 is the major VEGF receptor in human malignancies. VEGFR2 is highly expressed in colon cancer endothelium and relates to increased tumor vascularity and high metastatic ability. Binding of VEGF to VEGFR2 on endothelial cells results in receptor phosphorylation and triggering of a cascade of events leading to endothelial cell proliferation, migration, apoptosis inhibition and maturation of vascular structures. Human VEGFR2 gene is mapped to chromosome 4q11-q12. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.