VAMP 1 (Vesicle Associated Membrane Protein 1, Vesicle-associated Membrane Protein 1, VAMP1, VAMP-1, DKFZp686H12131, Synaptobrevin 1, Synaptobrevin-1, SYB1, SYB-1, DKFZp686H12131)

Size

£685.00

SKU:: 135197
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa28-97 from human VAMP1 (NP_055046) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5A4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Synaptobrevins/VAMPs, syntaxins, and the 25kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. VAMP1 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Multiple alternative splice variants that encode proteins with alternative carboxy ends have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice