135185-APC

USP9X (Ubiquitin-specific Protease 9, X Chromosome, USP9, Probable Ubiquitin Carboxyl-terminal Hydrolase FAF-X, Deubiquitinating Enzyme FAF-X, DFFRX, Fat Facets in Mammals, FAM, hFAM, Fat Facets Protein-related, X-linked, Ubiquitin Thioesterase FAF-X, Ubiquitin-specific-processing Protease FAF-X) (APC)

Size

£927.00

SKU:: 135185-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-91 from USP9X (NP_068706) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5D7
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.