USP6 (Ubiquitin-specific-processing Protease 6, Ubiquitin Carboxyl-terminal Hydrolase 6, Deubiquitinating Enzyme 6, HRP1, Proto-oncogene TRE-2, TRE2, TRE17, Ubiquitin Thioesterase 6)

Size

£685.00

SKU:: 135184
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-90 from USP6 (NP_004496) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.