135171-APC

USP33 (Ubiquitin-specific-processing Protease 33, Ubiquitin Carboxyl-terminal Hydrolase 33, Deubiquitinating Enzyme 33, Ubiquitin Thioesterase 33, VHL-interacting Deubiquitinating Enzyme 1, VDU1, hVDU1, KIAA1097) (APC)

Size

£927.00

SKU:: 135171-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa327-427 from USP33 (NP_055832) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5B5
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Immunofluorescence: 20ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQIL* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.