USP14 (Ubiquitin-specific-processing Protease 14, Ubiquitin Carboxyl-terminal Hydrolase 14, Deubiquitinating Enzyme 14, Ubiquitin Thioesterase 14, TGT)

Size

£685.00

SKU:: 135151
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa395-495 from USP14 (NP_005142) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6D6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 20ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.