Urokinase (Urokinase-type Plasminogen Activator, U-plasminogen Activator, uPA, PLAU)

Size

£685.00

SKU:: 135133
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa16-115 from human PLAU (AAH13575) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Urokinase is a serine protease involved in degradation of the extracellular matrix and possibly tumor cell migration and proliferation. A specific polymorphism in the Urokinase gene may be associated with late onset Alzheimer disease and also with decreased affinity for fibrin binding. This protein converts plasminogen to plasmin by specific cleavage of an Arg Val bond in plasminogen. The proprotein is cleaved at a Lys Ile bond by plasmin to form a two chain derivative in which a single disulfide bond connects the amino terminal A chain to the catalytically active, carboxy terminal B chain. This two chain derivative is also called HMW uPA (high molecular weight uPA). HMW uPA can be further processed into LMW uPA (low molecular weight uPA) by cleavage of chain A into a short chain A (A1) and an amino terminal fragment. LMW uPA is proteolytically active but does not bind to the uPA receptor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice