135133-ML490
Urokinase (Urokinase-type Plasminogen Activator, U-plasminogen Activator, uPA, PLAU) (MaxLight 490)
Size
£914.00
- SKU:
- 135133-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa16-115 from human PLAU (AAH13575) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Urokinase is a serine protease involved in degradation of the extracellular matrix and possibly tumor cell migration and proliferation. A specific polymorphism in the Urokinase gene may be associated with late onset Alzheimer disease and also with decreased affinity for fibrin binding. This protein converts plasminogen to plasmin by specific cleavage of an Arg Val bond in plasminogen. The proprotein is cleaved at a Lys Ile bond by plasmin to form a two chain derivative in which a single disulfide bond connects the amino terminal A chain to the catalytically active, carboxy terminal B chain. This two chain derivative is also called HMW uPA (high molecular weight uPA). HMW uPA can be further processed into LMW uPA (low molecular weight uPA) by cleavage of chain A into a short chain A (A1) and an amino terminal fragment. LMW uPA is proteolytically active but does not bind to the uPA receptor. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice