UQCRH (Cytochrome b-c1 Complex Subunit 6, Mitochondrial, Complex III Subunit 6, Complex III Subunit VIII, Cytochrome c1 Non-heme 11kD Protein, Mitochondrial Hinge Protein, Ubiquinol-cytochrome c Reductase Complex 11kD Protein)

Size

£685.00

SKU:: 135129
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-91 from human UQCRH (AAH15177) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.