UHRF2 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 2, Ubiquitin-like-containing PHD and RING Finger Domains Protein 2, E3 Ubiquitin-protein Ligase UHRF2, Np95/ICBP90-like RING Finger Protein, NIRF, Np95-like RING Finger Protein, Nuclear Protein 97, Nuclear Zinc Finger Protein Np97, RING Finger Protein 107, RNF107)

Size

£685.00

SKU:: 135084
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa81-181 from human UHRF2 (NP_690856) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.