135084-ML650

UHRF2 (Ubiquitin-like PHD and RING Finger Domain-containing Protein 2, Ubiquitin-like-containing PHD and RING Finger Domains Protein 2, E3 Ubiquitin-protein Ligase UHRF2, Np95/ICBP90-like RING Finger Protein, NIRF, Np95-like RING Finger Protein, Nuclear Protein 97, Nuclear Zinc Finger Protein Np97, RING Finger Protein 107, RNF107) (MaxLight 650)

Size

£914.00

SKU:: 135084-ML650
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa81-181 from human UHRF2 (NP_690856) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Extra Details:: MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.